PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462861845
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 1207aa    MW: 132313 Da    PI: 8.6827
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462861845genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.12.3e-06126182157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                +++R  ++++ ++ +++ F+ + ++ ++e +e++  +g+t +qV+ +F   R +++k
  462861845 126 KKPRDLLNPKAVKYMQSIFALKDTIGKKETREISVLCGVTVTQVREFFASERSRMRK 182
                799****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.908123183IPR001356Homeobox domain
SMARTSM003890.0011125187IPR001356Homeobox domain
SuperFamilySSF466895.13E-6125185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-5126186IPR009057Homeodomain-like
CDDcd000866.77E-4126182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1207 aa     Download sequence    Send to blast
ENPAHRNTVP SHLVRVPISF LLLAPHLQTL TPPRRRPPPR HHTAQQKGQP DAQPPVGPME  60
LVAFKPAAGG GADAGSIPAM VAAQQEMLHT QVDQLQSLVI TQCRLTGVNP LAQEMAAGAL  120
SIKIGKKPRD LLNPKAVKYM QSIFALKDTI GKKETREISV LCGVTVTQVR EFFASERSRM  180
RKVVNLSREK ALKIEAPKEH HDSCSITTEQ TPLDIEARAE IIEPLRTLGP VEVPRSSSQP  240
TDVPQFYLQP VLVPQSSLQP TDALQNSLQQ AEVQQNHADP IIPSGTIPVQ PTDAKINPDS  300
VRKESKEDEV PGVESEDKKF FDSIFALTQK EETFSGQVKL MDWILQINNI TILSWFVTMG  360
GLTIVSAWLS QAAVEEQTSV ILVIFKVLLH LPLHKALPAH MSTVLQTINR LRFYRTQDIS  420
SKAKIILARL SKVLVRSKAL KMPQKDLTEK QRISEILRDE SWKSEVGITE EILALTDGAN  480
ENRKPEPRKT PMLLTASADE PSKKSAPQTK SKQKRKVLLV EHPNKKAAGK NAHSVRSIST  540
NNSRPLSADD IQKAKMRAMF MQEKYGKVDT GKASDKLQAM ETQKSSGFHN SIVPPLPKSP  600
VTSTTKEPVD LSPQTSKQST VPQTDKAEPA DGLKLKMSSP KHVIEKLDSK RVLWQIPPAV  660
WIDPSWSVGA GENSKELEVQ TQRNRREKET FYANQRDIPL NPKDPWDLEM DFDDSLTPEI  720
PIEQQPDADN METDTVGTAP PAIVDPVDDK QIESTSSTSV ADASCANDAD KPDFELLAVL  780
LKNPQLVFAL TSNKGENVPS EQTIALLDTL KRTGLELSDL VNNLANGAAA APKEPPQPEP  840
VPTSLPSPTP ASDHTAMAGW GPEHPTQARA PSVQHPQSSN RGNTPPIGNT VQQSFSNVVS  900
SLPSQPYASV SVLPAQNQVN VPSLPQLAAS VNPPIQHVSP VNNHPNRASV HQHAQQYALV  960
SDPVAVSFHQ QPAVNKVTHG LENISNPAVA HASMSESNAS HTTFPWQSNV APVTSTGRGT  1020
SPDPWAVRTS NSYNIASTNT VPYANQNFYG NHSAQNGLGA YGSVSVSSHA VLPAHAPDRN  1080
GYSHSAEYQT LARDSHRRHS KSPELVGSGH DYGGTQGYNA RTWNGAGQQS YNPEPSRQLI  1140
SARQSYTSAE PSRQQWSSGH QSYSFEPSRP WSSSQQGQNP ETSRPWNLGN QDQYNPNGRR  1200
SYDRWRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1807812DTLKRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971183.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLK3XDW20.0K3XDW2_SETIT; Uncharacterized protein
STRINGSi000079m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80433034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-100HB-other family protein